PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G14170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 216aa    MW: 22044.3 Da    PI: 10.8356
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G14170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41109186178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+C +dlsea +y+rrhkvC++hsk pvvlv+gl+qrfCqqCsrfhel+efD++krsCrrrLa+hnerrrk++a
  ONIVA07G14170.1 109 RCQVERCGVDLSEAGRYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELTEFDDAKRSCRRRLAGHNERRRKSAA 186
                      6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-34103171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.351107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-38108188IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MDRKDKARKN FSSSSSSSAA SMAALAAAAA AGDGGAALPS PMEEDKKPRL VASSLAPVAG  60
GGGGGSSSSA AVAAGASSSS SSSSVAAAAR RGAGRAGGGA PSGGGGGPRC QVERCGVDLS  120
EAGRYNRRHK VCQTHSKEPV VLVAGLRQRF CQQCSRFHEL TEFDDAKRSC RRRLAGHNER  180
RRKSAADTAH GENCRHADQD AGRSHQGTGN PPFQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-36102183384squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8995810.0KT899581.1 Oryza sativa Japonica Group isolate Dongjing GLW7 (GLW7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645415.11e-151PREDICTED: squamosa promoter-binding-like protein 13
SwissprotQ6Z4611e-153SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A0E0I1A61e-151A0A0E0I1A6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0Q8R11e-151A0A0E0Q8R1_ORYRU; Uncharacterized protein
TrEMBLB8B6F81e-151B8B6F8_ORYSI; Putative uncharacterized protein
TrEMBLC7J4X61e-151C7J4X6_ORYSJ; GLW7
STRINGLOC_Os07g32170.11e-150(Oryza sativa Japonica Group)
STRINGBGIOSGA024253-PA1e-150(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-37squamosa promoter binding protein-like 4